SENP3 Antibody
| Name | SENP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32525 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SENP3 Protein |
| Description | Rabbit Polyclonal |
| Gene | SENP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SENP3 Antibody [NBP2-32525] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8199_SENP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32525-img0007.jpg)
![Immunohistochemistry-Paraffin: SENP3 Antibody [NBP2-32525] - Staining of human lateral ventricle shows moderate nucleolar positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8200_SENP3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32525-img0008.jpg)