DOK7 Antibody
| Name | DOK7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32465 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DOK7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DOK7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: DOK7 Antibody [NBP2-32465] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11583_DOK7%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32465-img0007.jpg)
![Immunohistochemistry-Paraffin: DOK7 Antibody [NBP2-32465] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11584_DOK7-Antibody-Immunohistochemistry-Paraffin-NBP2-32465-img0008.jpg)