IRX3 Antibody
| Name | IRX3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32363 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IRX3 Protein |
| Description | Rabbit Polyclonal |
| Gene | IRX3 |
| Supplier Page | Shop |
![Immunohistochemistry: IRX3 Antibody [NBP2-32363] - Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7366_IRX3-Antibody-Immunohistochemistry-NBP2-32363-img0001.jpg)
![Immunohistochemistry: IRX3 Antibody [NBP2-32363] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7367_IRX3-Antibody-Immunohistochemistry-NBP2-32363-img0002.jpg)
![Immunohistochemistry: IRX3 Antibody [NBP2-32363] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7370_IRX3%2520Antibody-Immunohistochemistry-NBP2-32363-img0006.jpg)