JM4 Antibody
| Name | JM4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87886 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | JM4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRAF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9455_JM4-Antibody-Western-Blot-NBP1-87886-img0003.jpg)
Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9456_JM4-Antibody-Immunohistochemistry-Paraffin-NBP1-87886-img0001.jpg)
Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
![Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9457_JM4%2520Antibody-Western%2520Blot-NBP1-87886-img0004.jpg)
Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp