SLC23A2 Antibody
| Name | SLC23A2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13319 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC23A2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC23A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC23A2 Antibody [NBP2-13319] - Analysis in human adrenal gland tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10227_SLC23A2%2520Antibody-Western%2520Blot-NBP2-13319-img0005.jpg)
![Immunohistochemistry-Paraffin: SLC23A2 Antibody [NBP2-13319] - Staining of human rectum shows distinct cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10228_SLC23A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13319-img0001.jpg)