SLC23A2 Recombinant Protein Antigen

Name SLC23A2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-13319PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SLC23A2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC23A1
Sequence DKWKCNTTDVSVANGTAELLHTEHIWYPRI
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC23A2
Supplier Page Shop