HMGCS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54623
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to HMGCS1(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)) The peptide sequence was selected from the middle region of HMGCS1. Peptide sequence KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: HMGCS1
• Conjugate: Unconjugated