PLUNC Antibody
| Name | PLUNC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58979 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PLUNC(palate, lung and nasal epithelium carcinoma associated) The peptide sequence was selected from the middle region of PLUNC (NP_057667). Peptide sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BPIFA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PLUNC Antibody [NBP1-58979] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14259_PLUNC-Antibody-Western-Blot-NBP1-58979-img0005.jpg)
Western Blot: PLUNC Antibody [NBP1-58979] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: PLUNC Antibody [NBP1-58979] - Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-PLUNC antibody](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14260_PLUNC-Antibody-Immunohistochemistry-NBP1-58979-img0004.jpg)
Immunohistochemistry: PLUNC Antibody [NBP1-58979] - Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-PLUNC antibody
![Western Blot: PLUNC Antibody [NBP1-58979] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14261_PLUNC-Antibody-Western-Blot-NBP1-58979-img0002.jpg)
Western Blot: PLUNC Antibody [NBP1-58979] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml