PCBP2 Antibody
| Name | PCBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57323 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PCBP2 (poly(rC) binding protein 2) The peptide sequence was selected from the middle region of PCBP2 (NP_005007). Peptide sequence VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PCBP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PCBP2 Antibody [NBP1-57323] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14402_PCBP2-Antibody-Western-Blot-NBP1-57323-img0005.jpg)
Western Blot: PCBP2 Antibody [NBP1-57323] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: PCBP2 Antibody [NBP1-57323] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14403_PCBP2-Antibody-Immunohistochemistry-NBP1-57323-img0004.jpg)
Immunohistochemistry: PCBP2 Antibody [NBP1-57323] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Western Blot: PCBP2 Antibody [NBP1-57323] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14404_PCBP2%2520Antibody-Western%2520Blot-NBP1-57323-img0006.jpg)
Western Blot: PCBP2 Antibody [NBP1-57323] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat