TRA2B Antibody
| Name | TRA2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57456 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) The peptide sequence was selected from the N terminal of SFRS10. Peptide sequence MSDSGEQNYGERESRSASRSGSAHGSGKSARHTP |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TRA2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TRA2B Antibody [NBP1-57456] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14473_TRA2B-Antibody-Western-Blot-NBP1-57456-img0004.jpg)
Western Blot: TRA2B Antibody [NBP1-57456] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: TRA2B Antibody [NBP1-57456] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14474_TRA2B-Antibody-Immunohistochemistry-Paraffin-NBP1-57456-img0005.jpg)
Immunohistochemistry-Paraffin: TRA2B Antibody [NBP1-57456] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
![Immunohistochemistry-Paraffin: TRA2B Antibody [NBP1-57456] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14475_TRA2B-Antibody-Immunohistochemistry-Paraffin-NBP1-57456-img0003.jpg)
Immunohistochemistry-Paraffin: TRA2B Antibody [NBP1-57456] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.