FARS2 Antibody
| Name | FARS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57378 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FARS2(phenylalanyl-tRNA synthetase 2, mitochondrial) The peptide sequence was selected from the N terminal of FARS2. Peptide sequence VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FARS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FARS2 Antibody [NBP1-57378] - Transfected 293T, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24804_FARS2-Antibody-Western-Blot-NBP1-57378-img0001.jpg)
![Immunohistochemistry-Paraffin: FARS2 Antibody [NBP1-57378] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24805_FARS2-Antibody-Immunohistochemistry-Paraffin-NBP1-57378-img0003.jpg)