PABPC4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57448
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PABPC4 (poly(A) binding protein, cytoplasmic 4 (inducible form)) The peptide sequence was selected from the N terminal of PABPC4. Peptide sequence AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: PABPC4
• Conjugate: Unconjugated