SF3B4 Antibody
| Name | SF3B4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57419 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SF3B4 (splicing factor 3b, subunit 4, 49kDa) The peptide sequence was selected from the N terminal of SF3B4. Peptide sequence QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SF3B4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SF3B4 Antibody [NBP1-57419] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24600_SF3B4-Antibody-Western-Blot-NBP1-57419-img0001.jpg)
Western Blot: SF3B4 Antibody [NBP1-57419] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: SF3B4 Antibody [NBP1-57419] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24601_SF3B4-Antibody-Immunohistochemistry-Paraffin-NBP1-57419-img0002.jpg)
Immunohistochemistry-Paraffin: SF3B4 Antibody [NBP1-57419] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.