OVCA1 Antibody
| Name | OVCA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56693 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to DPH1(DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DPH1. Peptide sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DPH1 |
| Supplier Page | Shop |
Product images
![Western Blot: OVCA1 Antibody [NBP1-56693] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9648_OVCA1-Antibody-Western-Blot-NBP1-56693-img0002.jpg)
Western Blot: OVCA1 Antibody [NBP1-56693] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP1-56693] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9649_OVCA1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-56693-img0003.jpg)
Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP1-56693] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100