RP2 Antibody
| Name | RP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56852 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RP2(retinitis pigmentosa 2 (X-linked recessive)) The peptide sequence was selected from the middle region of RP2. Peptide sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RP2 Antibody [NBP1-56852] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24107_RP2%2520Antibody-Western%2520Blot-NBP1-56852-img0001.jpg)
![Immunohistochemistry-Paraffin: RP2 Antibody [NBP1-56852] - Human Brain, cerebellum tissue at an antibody concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24108_RP2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-56852-img0004.jpg)