SLC7A7 Antibody
| Name | SLC7A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59856 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC7A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24896_SLC7A7-Antibody-Western-Blot-NBP1-59856-img0003.jpg)
![Western Blot: SLC7A7 Antibody [NBP1-59856] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24897_SLC7A7-Antibody-Western-Blot-NBP1-59856-img0002.jpg)
![Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24898_SLC7A7%2520Antibody-Western%2520Blot-NBP1-59856-img0004.jpg)