GPR161 Antibody
| Name | GPR161 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60122 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the middle region of GPR161. Peptide sequence FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GPR161 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GPR161 Antibody [NBP1-60122] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14648_GPR161-Antibody-Western-Blot-NBP1-60122-img0001.jpg)
![Immunohistochemistry-Paraffin: GPR161 Antibody [NBP1-60122] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14649_GPR161-Antibody-Immunohistochemistry-Paraffin-NBP1-60122-img0003.jpg)