SLC14A1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-60115
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC14A1(solute carrier family 14 (urea transporter), member 1 (Kidd blood group)) The peptide sequence was selected from the C terminal of SLC14A1. Peptide sequence LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGF
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC14A1
• Conjugate: Unconjugated