GPAA1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62435
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GPAA1(glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)) The peptide sequence was selected from the C terminal of GPAA1. Peptide sequence LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALL
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GPAA1
• Conjugate: Unconjugated

Product images

Western Blot: GPAA1 Antibody [NBP1-62435] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry: GPAA1 Antibody [NBP1-62435] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time

Immunohistochemistry-Paraffin: GPAA1 Antibody [NBP1-62435] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Immunohistochemistry: GPAA1 Antibody [NBP1-62435] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.