Viperin Antibody
| Name | Viperin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58021 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RSAD2(radical S-adenosyl methionine domain containing 2) The peptide sequence was selected from the C terminal of RSAD2. Peptide sequence YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RSAD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Viperin Antibody [NBP1-58021] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24815_Viperin-Antibody-Western-Blot-NBP1-58021-img0002.jpg)
Western Blot: Viperin Antibody [NBP1-58021] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: Viperin Antibody [NBP1-58021] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24816_Viperin-Antibody-Immunohistochemistry-Paraffin-NBP1-58021-img0003.jpg)
Immunohistochemistry-Paraffin: Viperin Antibody [NBP1-58021] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.