Lysine Hydroxylase 2/PLOD2 Antibody
| Name | Lysine Hydroxylase 2/PLOD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58004 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PLOD2(procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2) The peptide sequence was selected from the middle region of PLOD2. Peptide sequence IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLOD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Lysine Hydroxylase 2/PLOD2 Antibody [NBP1-58004] - Titration: 0.2-1 ug/ml, Positive Control: DU145 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24349_Lysine-Hydroxylase-2-PLOD2-Antibody-Western-Blot-NBP1-58004-img0003.jpg)
Western Blot: Lysine Hydroxylase 2/PLOD2 Antibody [NBP1-58004] - Titration: 0.2-1 ug/ml, Positive Control: DU145 cell lysate.
![Immunocytochemistry/Immunofluorescence: Lysine Hydroxylase 2/PLOD2 Antibody [NBP1-58004] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24350_Lysine-Hydroxylase-2-PLOD2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-58004-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Lysine Hydroxylase 2/PLOD2 Antibody [NBP1-58004] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1:100