| Name | HERC5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58102 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the middle region of HERC5. Peptide sequence FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HERC5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |