HYPE Antibody
| Name | HYPE Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58290 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FICD(FIC domain containing) The peptide sequence was selected from the C terminal of FICD. Peptide sequence GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FICD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HYPE Antibody [NBP1-58290] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24446_HYPE-Antibody-Western-Blot-NBP1-58290-img0001.jpg)
![Immunohistochemistry-Paraffin: HYPE Antibody [NBP1-58290] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24447_HYPE-Antibody-Immunohistochemistry-Paraffin-NBP1-58290-img0003.jpg)