RhoD Antibody

Name RhoD Antibody
Supplier Novus Biologicals
Catalog NBP1-58359
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to RHOD(ras homolog gene family, member D) The peptide sequence was selected from the C terminal of RHOD. Peptide sequence NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RHOD
Conjugate Unconjugated
Supplier Page Shop

Product images