Histone H2AY/macroH2A.1 Antibody
| Name | Histone H2AY/macroH2A.1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53018 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to macroH2A.1. The peptide sequence was selected from the N terminal of macroH2A.1. Peptide sequence MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | H2AFY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53018] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17255_Histone-H2AY-macroH2A.1-Antibody-Western-Blot-NBP1-53018-img0002.jpg)
Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53018] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.