PARP3 Antibody
| Name | PARP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53011 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to PARP3 (poly (ADP-ribose) polymerase family, member 3) The peptide sequence was selected from the C terminal of PARP3. Peptide sequence LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PARP3 |
| Supplier Page | Shop |
![Western Blot: PARP3 Antibody [NBP1-53011] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9829_PARP3%2520Antibody-Western%2520Blot-NBP1-53011-img0001.jpg)
![Immunohistochemistry-Paraffin: PARP3 Antibody [NBP1-53011] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9830_PARP3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-53011-img0002.jpg)