NMNAT-1 Antibody
| Name | NMNAT-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52973 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NMNAT1(nicotinamide nucleotide adenylyltransferase 1) The peptide sequence was selected from the N terminal of NMNAT1 (NP_073624). Peptide sequence PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NMNAT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NMNAT-1 Antibody [NBP1-52973] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19841_NMNAT-1-Antibody-Western-Blot-NBP1-52973-img0004.jpg)
![Western Blot: NMNAT-1 Antibody [NBP1-52973] - Reccomended Titration: 0.25 ug/ml Positive Control: HepG2 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19842_NMNAT-1%2520Antibody-Western%2520Blot-NBP1-52973-img0005.jpg)