Slap Antibody
| Name | Slap Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52966 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLA(Src-like-adaptor) The peptide sequence was selected from the middle region of SLA. Peptide sequence PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Slap Antibody [NBP1-52966] - OVCAR-3 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24753_Slap%2520Antibody-Western%2520Blot-NBP1-52966-img0002.jpg)
![Immunohistochemistry-Paraffin: Slap Antibody [NBP1-52966] - Human Spleen cell tissue, 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24754_Slap%2520Antibody-Immunohistochemistry-Paraffin-NBP1-52966-img0003.jpg)