NASP Antibody
| Name | NASP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52914 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NASP(nuclear autoantigenic sperm protein (histone-binding)) The peptide sequence was selected from the middle region of NASP. Peptide sequence KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NASP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NASP Antibody [NBP1-52914] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: HepG2 cell lysate NASP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24936_NASP%2520Antibody-Western%2520Blot-NBP1-52914-img0003.jpg)
Western Blot: NASP Antibody [NBP1-52914] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: HepG2 cell lysate NASP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
![Immunohistochemistry-Paraffin: NASP Antibody [NBP1-52914] - Human Testis Tissue, 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24937_NASP-Antibody-Immunohistochemistry-Paraffin-NBP1-52914-img0002.jpg)
Immunohistochemistry-Paraffin: NASP Antibody [NBP1-52914] - Human Testis Tissue, 4-8ug/ml.