LIN7C Antibody
| Name | LIN7C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53082 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LIN7C(lin-7 homolog C (C. elegans)) The peptide sequence was selected from the N terminal of LIN7C. Peptide sequence MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LIN7C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LIN7C Antibody [NBP1-53082] - HepG2 cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24832_LIN7C%2520Antibody-Western%2520Blot-NBP1-53082-img0001.jpg)
![Immunohistochemistry-Paraffin: LIN7C Antibody [NBP1-53082] - Human Colon Tissue, antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24833_LIN7C%2520Antibody-Immunohistochemistry-Paraffin-NBP1-53082-img0002.jpg)