Sphingosine 1 phosphate phosphatase 2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53181
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: SGPP2
• Conjugate: Unconjugated