ZNF385 Antibody
| Name | ZNF385 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80004 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF385. Peptide sequence EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF385A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF385 Antibody [NBP1-80004] - Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24365_ZNF385%2520Antibody-Western%2520Blot-NBP1-80004-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF385 Antibody [NBP1-80004] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24366_ZNF385%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80004-img0002.jpg)