MLC1 Antibody
| Name | MLC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80073 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide directed towards the middle region of human MLC1. Peptide sequence SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MLC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MLC1 Antibody [NBP1-80073] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24411_MLC1-Antibody-Western-Blot-NBP1-80073-img0003.jpg)
![Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-80073] - Rat Astrocytes, 20 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24412_MLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80073-img0002.jpg)
![Western Blot: MLC1 Antibody [NBP1-80073] - Human Fetal Spleen, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24413_MLC1%2520Antibody-Western%2520Blot-NBP1-80073-img0004.jpg)