Name | MLC1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80073 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Rat |
Antigen | Synthetic peptide directed towards the middle region of human MLC1. Peptide sequence SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MLC1 |
Conjugate | Unconjugated |
Supplier Page | Shop |