SOX7 Antibody
| Name | SOX7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80373 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human SOX7. Peptide sequence DKGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SOX7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SOX7 Antibody [NBP1-80373] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24494_SOX7%2520Antibody-Western%2520Blot-NBP1-80373-img0001.jpg)
![Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-80373] - Human Heart Tissue, antibody concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24495_SOX7%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80373-img0002.jpg)