GRHL3 Antibody

Name GRHL3 Antibody
Supplier Novus Biologicals
Catalog NBP1-80355
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GRHL3
Conjugate Unconjugated
Supplier Page Shop

Product images