PLEKHH2 Antibody
| Name | PLEKHH2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70677 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2. Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLEKHH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14568_PLEKHH2-Antibody-Western-Blot-NBP1-70677-img0003.jpg)
Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14569_PLEKHH2-Antibody-Immunohistochemistry-NBP1-70677-img0004.jpg)
Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.
![Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14570_PLEKHH2-Antibody-Immunohistochemistry-Paraffin-NBP1-70677-img0002.jpg)
Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.