ZNF385 Antibody
| Name | ZNF385 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79983 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Pig, Bovine, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptide directed towards the C terminal of human ZNF385. Peptide sequence LKQHISSRRHRDGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF385A |
| Supplier Page | Shop |
![Western Blot: ZNF385 Antibody [NBP1-79983] - K562 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10002_ZNF385%2520Antibody-Western%2520Blot-NBP1-79983-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF385 Antibody [NBP1-79983] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10003_ZNF385%2520Antibody-Immunohistochemistry-Paraffin-NBP1-79983-img0002.jpg)