CCR11 Antibody
| Name | CCR11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79925 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | The specific Immunogen is proprietary information. Peptide sequence SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACKR4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCR11 Antibody [NBP1-79925] - 293T cell Lysate, concentration 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14691_CCR11%2520Antibody-Western%2520Blot-NBP1-79925-img0004.jpg)
Western Blot: CCR11 Antibody [NBP1-79925] - 293T cell Lysate, concentration 1ug/ml.
![Immunohistochemistry-Paraffin: CCR11 Antibody [NBP1-79925] - Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary Dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary Dilution: 1:500, Image Submitted By: Chiara Foglieni, San Raffaele Scientific Inst](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14692_CCR11%2520Antibody-Immunohistochemistry-Paraffin-NBP1-79925-img0005.jpg)
Immunohistochemistry-Paraffin: CCR11 Antibody [NBP1-79925] - Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary Dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary Dilution: 1:500, Image Submitted By: Chiara Foglieni, San Raffaele Scientific Inst