MTR Antibody
| Name | MTR Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79285 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human MTR. The immunogen for this antibody is MTR. Peptide sequence GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MTR Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | MTR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MTR Antibody [NBP1-79285] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14657_MTR-Antibody-Western-Blot-NBP1-79285-img0002.jpg)
![Immunohistochemistry-Paraffin: MTR Antibody [NBP1-79285] - Pancreas tissue 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14658_MTR-Antibody-Immunohistochemistry-Paraffin-NBP1-79285-img0003.jpg)