ARID5A Antibody
| Name | ARID5A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79441 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ARID5AThe immunogen for this antibody is ARID5A. Peptide sequence MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARID5A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ARID5A Antibody [NBP1-79441] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14579_ARID5A-Antibody-Western-Blot-NBP1-79441-img0004.jpg)
Western Blot: ARID5A Antibody [NBP1-79441] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: ARID5A Antibody [NBP1-79441] - Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ARID5A antibody](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14580_ARID5A-Antibody-Immunohistochemistry-NBP1-79441-img0003.jpg)
Immunohistochemistry: ARID5A Antibody [NBP1-79441] - Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ARID5A antibody
![Western Blot: ARID5A Antibody [NBP1-79441] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14581_ARID5A-Antibody-Western-Blot-NBP1-79441-img0001.jpg)
Western Blot: ARID5A Antibody [NBP1-79441] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml