Norrin/NDP Antibody
| Name | Norrin/NDP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59305 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NDP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NDP/Norrin Antibody [NBP1-59305] - Fetal Liver tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14524_NDP-Norrin%2520Antibody-Western%2520Blot-NBP1-59305-img0001.jpg)
![Immunohistochemistry-Paraffin: NDP/Norrin Antibody [NBP1-59305] - Human Brain, cortex tissue at an antibody concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14525_NDP-Norrin%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59305-img0004.jpg)