Neuregulin-3/NRG3 Antibody
| Name | Neuregulin-3/NRG3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59338 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NRG3(neuregulin 3) The peptide sequence was selected from the middle region of NRG3. Peptide sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NRG3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Neuregulin 3 Antibody [NBP1-59338] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24344_Neuregulin%25203%2520Antibody-Western%2520Blot-NBP1-59338-img0001.jpg)
![Immunohistochemistry-Paraffin: Neuregulin 3 Antibody [NBP1-59338] - Human Brain, cortex tissue at an antibody concentration of 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24345_Neuregulin%25203%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59338-img0003.jpg)