SMCR7L Antibody
| Name | SMCR7L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59480 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SMCR7L(Smith-Magenis syndrome chromosome region, candidate 7-like) The peptide sequence was selected from the N terminal of SMCR7L. Peptide sequence GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MIEF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SMCR7L Antibody [NBP1-59480] - Human Fetal Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24710_SMCR7L-Antibody-Western-Blot-NBP1-59480-img0004.jpg)
![Western Blot: SMCR7L Antibody [NBP1-59480] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24711_SMCR7L-Antibody-Western-Blot-NBP1-59480-img0006.jpg)
![Western Blot: SMCR7L Antibody [NBP1-59480] - Human Fetal Heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24712_SMCR7L-Antibody-Western-Blot-NBP1-59480-img0005.jpg)