Name | SMCR7L Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59480 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SMCR7L(Smith-Magenis syndrome chromosome region, candidate 7-like) The peptide sequence was selected from the N terminal of SMCR7L. Peptide sequence GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MIEF1 |
Conjugate | Unconjugated |
Supplier Page | Shop |