DCUN1D1 Antibody

Name DCUN1D1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56537
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to DCUN1D1(DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)) The peptide sequence was selected from the N terminal of DCUN1D1. Peptide sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKK
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DCUN1D1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.