RGS20 Antibody
| Name | RGS20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54885 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human RGS20 (NP_003693). Peptide sequence NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RGS20 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RGS20 Antibody [NBP1-54885] - Titration: 2.5ug/ml Positive Control: Human brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24861_RGS20%2520Antibody-Western%2520Blot-NBP1-54885-img0001.jpg)
Western Blot: RGS20 Antibody [NBP1-54885] - Titration: 2.5ug/ml Positive Control: Human brain.
![Immunohistochemistry-Paraffin: RGS20 Antibody [NBP1-54885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24862_RGS20%2520Antibody-Immunohistochemistry-Paraffin-NBP1-54885-img0003.jpg)
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP1-54885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.