GLS2 Antibody
| Name | GLS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54773 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GLS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GLS2 Antibody [NBP1-54773] - Sample Tissue: Human NCI-H226 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14370_GLS2-Antibody-Western-Blot-NBP1-54773-img0006.jpg)
![Immunohistochemistry: GLS2 Antibody [NBP1-54773] - Human kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14371_GLS2-Antibody-Immunohistochemistry-NBP1-54773-img0005.jpg)
![Western Blot: GLS2 Antibody [NBP1-54773] - Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14372_GLS2-Antibody-Western-Blot-NBP1-54773-img0004.jpg)