FBXL5 Antibody
| Name | FBXL5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54918 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FBXL5(F-box and leucine-rich repeat protein 5) The peptide sequence was selected from the middle region of FBXL5. Peptide sequence VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FBXL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FBXL5 Antibody [NBP1-54918] - HepG2 cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24824_FBXL5-Antibody-Western-Blot-NBP1-54918-img0001.jpg)
![Immunohistochemistry-Paraffin: FBXL5 Antibody [NBP1-54918] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24825_FBXL5-Antibody-Immunohistochemistry-Paraffin-NBP1-54918-img0003.jpg)