RNF168 Antibody
| Name | RNF168 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55075 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RNF168(ring finger protein 168) The peptide sequence was selected from the C terminal of RNF168. Peptide sequence PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNF168 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RNF168 Antibody [NBP1-55075] - HepG2 cell lysate, concentration 0.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14290_RNF168-Antibody-Western-Blot-NBP1-55075-img0001.jpg)
![Immunohistochemistry-Paraffin: RNF168 Antibody [NBP1-55075] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14291_RNF168-Antibody-Immunohistochemistry-Paraffin-NBP1-55075-img0002.jpg)