GNL3L Antibody
| Name | GNL3L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55241 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GNL3L(guanine nucleotide binding protein-like 3 (nucleolar)-like) The peptide sequence was selected from the N terminal of GNL3L. Peptide sequence QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GNL3L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GNL3L Antibody [NBP1-55241] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14298_GNL3L%2520Antibody-Western%2520Blot-NBP1-55241-img0004.jpg)
Western Blot: GNL3L Antibody [NBP1-55241] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
![Immunocytochemistry/Immunofluorescence: GNL3L Antibody [NBP1-55241] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14299_GNL3L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-55241-img0003.jpg)
Immunocytochemistry/Immunofluorescence: GNL3L Antibody [NBP1-55241] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml
![Western Blot: GNL3L Antibody [NBP1-55241] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14300_GNL3L-Antibody-Western-Blot-NBP1-55241-img0002.jpg)
Western Blot: GNL3L Antibody [NBP1-55241] - Human Lung lysate, concentration 0.2-1 ug/ml.