SLC1A5 Antibody
| Name | SLC1A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59732 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMF |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC1A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC1A5 Antibody [NBP1-59732] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8895_SLC1A5-Antibody-Western-Blot-NBP1-59732-img0007.jpg)
Western Blot: SLC1A5 Antibody [NBP1-59732] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: SLC1A5 Antibody [NBP1-59732] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8896_SLC1A5-Antibody-Immunohistochemistry-NBP1-59732-img0006.jpg)
Immunohistochemistry: SLC1A5 Antibody [NBP1-59732] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Western Blot: SLC1A5 Antibody [NBP1-59732] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8897_SLC1A5-Antibody-Western-Blot-NBP1-59732-img0005.jpg)
Western Blot: SLC1A5 Antibody [NBP1-59732] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml